Loading...
Statistics
Advertisement

The Indian Idiot
www.theindianidiot.com/
The Indian Idiot provides you with trending & funny articles and reviews on Lifestyle, Technology, Bollywood, Pop culture, Desi Entertainment from India.

Theindianidiot.com

Advertisement
Conversion Technology Metas Server
Theindianidiot.com is hosted in United States / Houston . Theindianidiot.com uses HTTPS protocol. Number of used technologies: 11. First technologies: CSS, Flexslider, Google Font API, Number of used javascripts: 12. First javascripts: Jquery.js, Jquery-migrate.min.js, Tie.js, Number of used analytics tools: 2. First analytics tools: Google Analytics, WordPress Stats, Number of used plugins, modules: 4. Its server type is: nginx/1.10.1. Its CMS is: Wordpress.

Technologies in use by Theindianidiot.com

Technology

Number of occurences: 11
  • CSS
  • Flexslider
  • Google Font API
  • Gravatar
  • Html
  • Html5
  • Javascript
  • jQuery
  • Php
  • Pingback
  • SVG

Advertisement

Javascripts

Number of occurences: 12
  • jquery.js
  • jquery-migrate.min.js
  • tie.js
  • mashsb.min.js
  • devicepx-jetpack.js
  • gprofiles.js
  • wpgroho.js
  • tie-scripts.js
  • ilightbox.packed.js
  • wp-embed.min.js
  • isotope.js
  • e-201639.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 2
  • Google Analytics
  • WordPress Stats

Server Type

  • nginx/1.10.1

Social

Number of occurences: 1
  • Facebook Box

Used plugins, modules

Number of plugins and modules: 4
  • taqyeem
  • mashsharer
  • jetpack
  • wpgroho.js http:

Google Analytics ID

  • UA-81116452-1

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Theindianidiot.com

SSL certificate

    • name: /OU=Domain Control Validated/OU=Hosted by HostGator.com, LLC./OU=PositiveSSL Wildcard/CN=*.hostgator.com
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: Hosted by HostGator.com, LLC.
        • 2: PositiveSSL Wildcard
      • CN: *.hostgator.com
    • hash: dd92202f
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 33731708412500954451172688233094812607
    • validFrom: 151016000000Z
    • validTo: 181015235959Z
    • validFrom_time_t: 1444953600
    • validTo_time_t: 1539647999
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: 4B:D0:EA:16:17:0D:DC:C2:CF:F0:DB:13:1E:B2:1C:3B:57:B2:F2:16
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:*.hostgator.com, DNS:hostgator.com

Meta - Theindianidiot.com

Number of occurences: 14
  • Name: google-site-verification
    Content: 9R-oVoIh1C4FRE9B_Vof3Ncry-y5i8BDD0V1VdJgCNk
  • Name:
    Content: 2016-09-30T19:05:57+00:00
  • Name: description
    Content: The Indian Idiot provides you with trending & funny articles and reviews on Lifestyle, Technology, Bollywood, Pop culture, Desi Entertainment from India.
  • Name: robots
    Content: noodp
  • Name: keywords
    Content: The Indian Idiot, The Indian Idiot Facebook, The Indian Idiot Twitter, The Indian Idiot Website, The Indian Idiot Youtube, Desi Entertainment
  • Name: twitter:card
    Content: summary_large_image
  • Name: twitter:description
    Content: The Indian Idiot provides you with trending & funny articles and reviews on Lifestyle, Technology, Bollywood, Pop culture, Desi Entertainment from India.
  • Name: twitter:title
    Content: The Indian Idiot
  • Name: twitter:site
    Content: @charansh
  • Name: twitter:image
    Content: http://theindianidiot.com/wp-content/uploads/2016/04/watermark.png
  • Name: twitter:creator
    Content: @charansh
  • Name: generator
    Content: WordPress 4.6.1
  • Name: viewport
    Content: width=device-width, initial-scale=1.0
  • Name: msapplication-TileImage
    Content: http://theindianidiot.com/wp-content/uploads/2016/04/cropped-watermark.png

Server / Hosting

  • IP: 108.167.180.12
  • Latitude: 29.83
  • Longitude: -95.47
  • Country: United States
  • City: Houston

Rname

  • ns8371.hostgator.com
  • ns8372.hostgator.com
  • mail.theindianidiot.com

Target

  • dnsadmin.gator4186.hostgator.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx/1.10.1 Date: Sat, 01 Oct 2016 20:45:51 GMT Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: Cookie Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: PHPSESSID=1c565fb7110a12d76bfb5c368202d664; path=/ Location: http://theindianidiot.com/ X-Cache: MISS from s_bd43 Via: 1.1 s_bd43 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 OK Server: nginx/1.10.1 Date: Sat, 01 Oct 2016 20:45:53 GMT Content-Type: text/html; charset=UTF-8 Vary: Cookie Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Link: ; rel="https://api.w.org/", ; rel=shortlink Set-Cookie: PHPSESSID=940684ddce45b76428c8229445a31a20; path=/ X-Cache: MISS from s_bd43 Transfer-Encoding: chunked Via: 1.1 s_bd43 (squid/3.5.20) Connection: keep-alive

DNS

host: theindianidiot.com
  1. class: IN
  2. ttl: 14400
  3. type: A
  4. ip: 108.167.180.12
host: theindianidiot.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns8371.hostgator.com
host: theindianidiot.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns8372.hostgator.com
host: theindianidiot.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns8371.hostgator.com
  5. rname: dnsadmin.gator4186.hostgator.com
  6. serial: 2016080103
  7. refresh: 86400
  8. retry: 7200
  9. expire: 3600000
  10. minimum-ttl: 86400
host: theindianidiot.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 0
  5. target: mail.theindianidiot.com
host: theindianidiot.com
  1. class: IN
  2. ttl: 14400
  3. type: TXT
  4. txt: v=spf1 a mx include:websitewelcome.com ~all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.heindianidiot.com, www.tqheindianidiot.com, www.qheindianidiot.com, www.taheindianidiot.com, www.aheindianidiot.com, www.t heindianidiot.com, www. heindianidiot.com, www.twheindianidiot.com, www.wheindianidiot.com, www.teheindianidiot.com, www.eheindianidiot.com, www.tzheindianidiot.com, www.zheindianidiot.com, www.txheindianidiot.com, www.xheindianidiot.com, www.tcheindianidiot.com, www.cheindianidiot.com, www.teindianidiot.com, www.theeindianidiot.com, www.teeindianidiot.com, www.thdeindianidiot.com, www.tdeindianidiot.com, www.thceindianidiot.com, www.tceindianidiot.com, www.thueindianidiot.com, www.tueindianidiot.com, www.thjeindianidiot.com, www.tjeindianidiot.com, www.theindianidiot.com, www.teindianidiot.com, www.thbeindianidiot.com, www.tbeindianidiot.com, www.thgeindianidiot.com, www.tgeindianidiot.com, www.thindianidiot.com, www.thexindianidiot.com, www.thxindianidiot.com, www.thesindianidiot.com, www.thsindianidiot.com, www.thewindianidiot.com, www.thwindianidiot.com, www.therindianidiot.com, www.thrindianidiot.com, www.thefindianidiot.com, www.thfindianidiot.com, www.thevindianidiot.com, www.thvindianidiot.com, www.thecindianidiot.com, www.thcindianidiot.com, www.theqindianidiot.com, www.thqindianidiot.com, www.theaindianidiot.com, www.thaindianidiot.com, www.theyindianidiot.com, www.thyindianidiot.com, www.thendianidiot.com, www.theirndianidiot.com, www.therndianidiot.com, www.theifndianidiot.com, www.thefndianidiot.com, www.theivndianidiot.com, www.thevndianidiot.com, www.theikndianidiot.com, www.thekndianidiot.com, www.thei,ndianidiot.com, www.the,ndianidiot.com, www.theibndianidiot.com, www.thebndianidiot.com, www.theigndianidiot.com, www.thegndianidiot.com, www.theitndianidiot.com, www.thetndianidiot.com, www.theiyndianidiot.com, www.theyndianidiot.com, www.theiundianidiot.com, www.theundianidiot.com, www.theijndianidiot.com, www.thejndianidiot.com, www.theimndianidiot.com, www.themndianidiot.com, www.theinndianidiot.com, www.thenndianidiot.com, www.theidianidiot.com, www.theinndianidiot.com, www.theindianidiot.com, www.theinhdianidiot.com, www.theihdianidiot.com, www.theinjdianidiot.com, www.theijdianidiot.com, www.theinkdianidiot.com, www.theikdianidiot.com, www.theinldianidiot.com, www.theildianidiot.com, www.thein dianidiot.com, www.thei dianidiot.com, www.theinianidiot.com, www.theindtianidiot.com, www.theintianidiot.com, www.theindgianidiot.com, www.theingianidiot.com, www.theindbianidiot.com, www.theinbianidiot.com, www.theindxianidiot.com, www.theinxianidiot.com, www.theindsianidiot.com, www.theinsianidiot.com, www.theindfianidiot.com, www.theinfianidiot.com, www.theindvianidiot.com, www.theinvianidiot.com, www.theindyianidiot.com, www.theinyianidiot.com, www.theindzianidiot.com, www.theinzianidiot.com, www.theindaianidiot.com, www.theinaianidiot.com, www.theindeianidiot.com, www.theineianidiot.com, www.theindrianidiot.com, www.theinrianidiot.com, www.theindanidiot.com, www.theindiranidiot.com, www.theindranidiot.com, www.theindifanidiot.com, www.theindfanidiot.com, www.theindivanidiot.com, www.theindvanidiot.com, www.theindikanidiot.com, www.theindkanidiot.com, www.theindi,anidiot.com, www.theind,anidiot.com, www.theindibanidiot.com, www.theindbanidiot.com, www.theindiganidiot.com, www.theindganidiot.com, www.theinditanidiot.com, www.theindtanidiot.com, www.theindiyanidiot.com, www.theindyanidiot.com, www.theindiuanidiot.com, www.theinduanidiot.com, www.theindijanidiot.com, www.theindjanidiot.com, www.theindimanidiot.com, www.theindmanidiot.com, www.theindinanidiot.com, www.theindnanidiot.com, www.theindinidiot.com, www.theindiaonidiot.com, www.theindionidiot.com, www.theindiapnidiot.com, www.theindipnidiot.com, www.theindia9nidiot.com, www.theindi9nidiot.com, www.theindianidiot.com, www.theindinidiot.com, www.theindiainidiot.com, www.theindiinidiot.com, www.theindiaunidiot.com, www.theindiunidiot.com,

Other websites we recently analyzed

  1. Touisset Golf Course
    Scottsdale (United States) - 68.178.254.120
    Server software: Apache
    Technology: PayPal, CSS, Html, Javascript, Php
    Number of Javascript: 1
    Number of meta tags: 1
  2. Главная
    Главная
    Amsterdam (Netherlands) - 5.79.84.48
    G Analytics ID: UA-25457449-1
    Server software: nginx
    Technology: CSS, Html, Javascript, Google Analytics, Add This, Facebook Box, Google +1 Button
    Number of Javascript: 4
    Number of meta tags: 4
  3. nimeshpatelkatyfamilyphysicians.com
    Wayne (United States) - 74.208.62.82
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  4. Керамическая плитка, доставка Киев и область, низкие цены в магазине КЕРАМИКА | (044) 227-68-60
    Магазин-склад КЕРАМИКА - большой выбор керамической плитки, мозаики, керамогранита, клинкера. Бесплатная доставка по Киеву.
    Kiev (Ukraine) - 193.169.188.224
    G Analytics ID: UA-42873655-2
    Server software: nginx admin
    Technology: BootstrapCDN, CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery UI, PageSpeed Module, Php, Yandex.Metrika, Google Analytics
    Number of Javascript: 14
    Number of meta tags: 6
  5. robbaldwin.org
    Scottsdale (United States) - 184.168.221.53
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  6. cockerdamen.de
    Germany - 94.102.216.158
    Server software: Apache/2.2.9 (Debian) DAV/2 mod_ssl/2.2.9 OpenSSL/0.9.8g PHP/5.2.6-1+lenny9 with Suhosin-Patch
    Technology: Html
    Number of meta tags: 1
  7. nasira.com - Diese Website steht zum Verkauf! - Informationen zum Thema nasira.
    Diese Website steht zum Verkauf! nasira.com ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf nasira.com alles. Wir hoffen, dass Sie hier das Gesuchte finden!
    Cambridge (United States) - 72.52.4.90
    Server software: Apache
    Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
    Number of Javascript: 4
    Number of meta tags: 5
  8. Home - Prime RE Group
    Prime RE Group
    Brisbane (Australia) - 202.174.106.117
    Server software: Apache
    Technology: CloudFlare, Maxcdn, OSS CDN, CSS, Google Font API, Html, Html5, Iframe, Javascript, Modernizr.js, Php, SVG, New Relic
    Number of Javascript: 17
    Number of meta tags: 9
  9. parablesofthepotter.com
    Wayne (United States) - 74.208.215.37
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  10. antitrustguru.info
    Germany - 217.160.230.214
    Server software: Apache
    Technology: Html
    Number of meta tags: 1

Check Other Websites